RNF160 (LTN1) Rabbit Polyclonal Antibody TA329857 from OriGene Technologies | Biocompare.com

Supplier Images

RNF160 (LTN1) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RNF160 (LTN1) Rabbit Polyclonal Antibody

OriGene Technologies' RNF160 (LTN1) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody.

Description

Rabbit Polyclonal Anti-LTN1 Antibody

Product Specs
ItemRNF160 (LTN1) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA329857
Quantity100 µl
Conjugate/TagUnconjugated
ReactivityHuman, Mouse
TargetLTN1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-ZNF294 antibody: synthetic peptide directed towards the N terminal of human ZNF294. Synthetic peptide located within the following region: MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA
NCBI Full Gene Namelisterin E3 ubiquitin protein ligase 1
NCBI Gene AliasesC21orf10, C21orf98, RNF160, ZNF294
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!